DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8128 and Nudt18

DIOPT Version :9

Sequence 1:NP_001285282.1 Gene:CG8128 / 32504 FlyBaseID:FBgn0030668 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001094202.1 Gene:Nudt18 / 361068 RGDID:1311802 Length:323 Species:Rattus norvegicus


Alignment Length:148 Identity:39/148 - (26%)
Similarity:65/148 - (43%) Gaps:29/148 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 INEQDEVLVVSDRFAMIPNSWKLPGGYVEPRENLIDAAIREVAEETGIRTEFRSVVSLRHAHGGT 233
            :|||||||::.:.......:|.||.|.:||.|.:::|..|||.||.|:..|..:::|:...    
  Rat    51 LNEQDEVLMIQEAKRECRGTWYLPAGRMEPGETIVEAMQREVKEEAGLLCEPVTLLSVEER---- 111

  Fly   234 FGCSDMYVVIALKPLN--LDFTR-CEREIARIQWMP---IAEYLK-HPQVH--ETNRQFVCTFLD 289
             |.|.:..|...:|..  |..:: .:.|..:..|.|   :...|: |..||  |...:|      
  Rat   112 -GASWIRFVFLARPTGGVLKTSKNADSESLQAGWYPRVSLPTPLRAHDVVHLVELGAKF------ 169

  Fly   290 YQKRGLTLTCRDEVHQVL 307
                     |:...|.::
  Rat   170 ---------CQQATHPLI 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8128NP_001285282.1 Nudix_Hydrolase_12 159..287 CDD:240027 37/126 (29%)
Nudt18NP_001094202.1 Nudix_Hydrolase_13 44..166 CDD:240028 36/119 (30%)
Nudix box 76..97 10/20 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.