DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8128 and Nudt18

DIOPT Version :10

Sequence 1:NP_573053.2 Gene:CG8128 / 32504 FlyBaseID:FBgn0030668 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_694776.2 Gene:Nudt18 / 213484 MGIID:2385853 Length:323 Species:Mus musculus


Alignment Length:101 Identity:31/101 - (30%)
Similarity:51/101 - (50%) Gaps:8/101 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 INEQDEVLVVSDRFAMIPNSWKLPGGYVEPRENLIDAAIREVAEETGIRTEFRSVVSLRHAHGGT 233
            :|||||||::.:.......:|.||.|.:||.|.:::|..|||.||.|:..|..:::|:...    
Mouse    51 LNEQDEVLMIQEAKRECRGTWYLPAGRMEPGETIVEAMQREVKEEAGLLCEPVTLLSVEER---- 111

  Fly   234 FGCSDMYVVIALKPLN--LDFTR-CEREIARIQWMP 266
             |.|.:..|...:|..  |..:: .:.|..:..|.|
Mouse   112 -GASWIRFVFLARPTGGVLKTSKDADSESLQAGWYP 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8128NP_573053.2 Nudix_hydro 67..146 CDD:465697
NUDIX_ASFGF2_Nudt6 159..290 CDD:467554 31/101 (31%)
Nudt18NP_694776.2 NUDIX_8DGDPP_Nudt18 44..173 CDD:467555 31/101 (31%)
Nudix box 76..97 10/20 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.