DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8128 and Nudt6

DIOPT Version :9

Sequence 1:NP_001285282.1 Gene:CG8128 / 32504 FlyBaseID:FBgn0030668 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_852028.1 Gene:Nudt6 / 207120 RGDID:621356 Length:313 Species:Rattus norvegicus


Alignment Length:207 Identity:78/207 - (37%)
Similarity:115/207 - (55%) Gaps:9/207 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RGITDRFAGVTVD-GRE---ENVDKSSFRDKLTKSLDFWTTNKNRAIWFRVYKEQADWVPILAEN 128
            :|..|||.|::|. .|.   ..:|.::||..|..::..|......|.|..:...|:.::...|..
  Rat    44 QGELDRFGGISVHLSRHRTLHRLDAAAFRRLLQAAIQQWRAEGRIAAWLHIPILQSHFIAPAASL 108

  Fly   129 GFDFHHAKTGVVVMYRWLPEHESSNLPTYAHTLMGVGGLVIN-EQDEVLVVSDRFAMIPNSWKLP 192
            ||.||||:..:..:..||.| ..|.||.||...:||.|.|.: ...:||||.|| ..:.|.||.|
  Rat   109 GFCFHHAEPHLSTLTLWLGE-GPSRLPGYATHQVGVAGAVFDVSTRKVLVVQDR-NKLKNMWKFP 171

  Fly   193 GGYVEPRENLIDAAIREVAEETGIRTEFRSVVSLRHAH--GGTFGCSDMYVVIALKPLNLDFTRC 255
            ||..||.|::.|.|:|||.||||:::||||::|:|..|  .|.||.||||::..|:|.:.....|
  Rat   172 GGLSEPGEDIGDTAVREVFEETGVKSEFRSLLSIRQQHRSPGAFGMSDMYLICRLQPRSFTINFC 236

  Fly   256 EREIARIQWMPI 267
            ::|..:.:||.:
  Rat   237 QQECLKCEWMDL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8128NP_001285282.1 Nudix_Hydrolase_12 159..287 CDD:240027 48/112 (43%)
Nudt6NP_852028.1 Nudix_hydro 43..126 CDD:408099 22/81 (27%)
Nudix_Hydrolase_12 139..271 CDD:240027 48/111 (43%)
Nudix box 173..194 11/20 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339902
Domainoid 1 1.000 93 1.000 Domainoid score I7378
eggNOG 1 0.900 - - E1_KOG0648
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31425
Inparanoid 1 1.050 132 1.000 Inparanoid score I4523
OMA 1 1.010 - - QHG50265
OrthoDB 1 1.010 - - D516644at33208
OrthoFinder 1 1.000 - - FOG0002753
OrthoInspector 1 1.000 - - oto96475
orthoMCL 1 0.900 - - OOG6_103452
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1840
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.670

Return to query results.
Submit another query.