DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8128 and ndx-1

DIOPT Version :9

Sequence 1:NP_001285282.1 Gene:CG8128 / 32504 FlyBaseID:FBgn0030668 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_493209.1 Gene:ndx-1 / 173138 WormBaseID:WBGene00003578 Length:365 Species:Caenorhabditis elegans


Alignment Length:217 Identity:53/217 - (24%)
Similarity:83/217 - (38%) Gaps:58/217 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 RWLPEHESSNLPTYAHTLMGVGGLVINEQDEVLVVSDRFAMIPNSWKLPGGYVEPRENLIDAAIR 208
            |::..|::.|....|..|...|     :..|||::.:........|.:|.|.||..|.:.:|.:|
 Worm    64 RYVRLHDNVNYVAAAIILRNQG-----DDTEVLLIQEAKKSCRGKWYMPAGRVEAGETIEEAVVR 123

  Fly   209 EVAEETGIRTEFRSVVSLRHAHGG----TFGC-----------------SDMYVVIALKPLNL-- 250
            ||.||||...:...::||:....|    .|.|                 ::.|.:..||...:  
 Worm   124 EVKEETGYSCDVVELLSLQVQGSGWYRYAFYCNITGGDLKTEPDQESLAAEWYNIKDLKANKVQL 188

  Fly   251 ---DFTRCEREIARIQWMPIAEYLKH------PQVHETNRQFVCTFLDY-----QKRGLTLTCRD 301
               ||.|...|        ...|..|      |:|...|:.....||::     .:.||    |.
 Worm   189 RGRDFIRLVDE--------AVTYRTHGPVDSIPRVMPLNQNVAGLFLEFMIVKHSRDGL----RT 241

  Fly   302 E--VHQVLKKKYNLYYVDREQP 321
            |  ||:.:|.:  .|.::.|||
 Worm   242 EVLVHKSIKDE--TYLLEEEQP 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8128NP_001285282.1 Nudix_Hydrolase_12 159..287 CDD:240027 36/159 (23%)
ndx-1NP_493209.1 Nudix_Hydrolase 74..200 CDD:294304 32/138 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.