DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8128 and NUDT6

DIOPT Version :9

Sequence 1:NP_001285282.1 Gene:CG8128 / 32504 FlyBaseID:FBgn0030668 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_009014.2 Gene:NUDT6 / 11162 HGNCID:8053 Length:316 Species:Homo sapiens


Alignment Length:274 Identity:95/274 - (34%)
Similarity:144/274 - (52%) Gaps:20/274 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RGITDRFAGVTV-----DGREENVDKSSFRDKLTKSLDFWTTNKNRAIWFRVYKEQADWVPILAE 127
            :|..|||.|::|     |.. :.:|.::|:..|..::..|.:....|:|..:...|:.::...|.
Human    47 QGELDRFGGISVRLARLDAL-DRLDAAAFQKGLQAAVQQWRSEGRTAVWLHIPILQSRFIAPAAS 110

  Fly   128 NGFDFHHAKTGVVVMYRWLPEHESSNLPTYAHTLMGVGGLVINEQD-EVLVVSDRFAMIPNSWKL 191
            .||.||||::....:..||.| ..|.||.||...:||.|.|.:|.. ::|||.|| ..:.|.||.
Human   111 LGFCFHHAESDSSTLTLWLRE-GPSRLPGYASHQVGVAGAVFDESTRKILVVQDR-NKLKNMWKF 173

  Fly   192 PGGYVEPRENLIDAAIREVAEETGIRTEFRSVVSLR--HAHGGTFGCSDMYVVIALKPLNLDFTR 254
            |||..||.|::.|.|:|||.|||||::|||||:|:|  |.:.|.||.||||::..|||.:.....
Human   174 PGGLSEPEEDIGDTAVREVFEETGIKSEFRSVLSIRQQHTNPGAFGKSDMYIICRLKPYSFTINF 238

  Fly   255 CEREIARIQWMPIAEYLK----HPQVHETNRQFVCTFLD-YQKRGLTLTCRDEVHQVLKKKYNLY 314
            |:.|..|.:||.:.:..|    .|......|..:..:.: :.|..||:.....|:..|  .|.||
Human   239 CQEECLRCEWMDLNDLAKTENTTPITSRVARLLLYGYREGFDKIDLTVEELPAVYTGL--FYKLY 301

  Fly   315 YVDREQPQEQQDKK 328
            :  :|.|:..:..|
Human   302 H--KELPENYKTMK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8128NP_001285282.1 Nudix_Hydrolase_12 159..287 CDD:240027 55/134 (41%)
NUDT6NP_009014.2 Nudix_Hydrolase_12 142..275 CDD:240027 55/133 (41%)
Nudix box 176..197 11/20 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146134
Domainoid 1 1.000 102 1.000 Domainoid score I6872
eggNOG 1 0.900 - - E1_KOG0648
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31425
Inparanoid 1 1.050 143 1.000 Inparanoid score I4464
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50265
OrthoDB 1 1.010 - - D516644at33208
OrthoFinder 1 1.000 - - FOG0002753
OrthoInspector 1 1.000 - - oto89348
orthoMCL 1 0.900 - - OOG6_103452
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8980
SonicParanoid 1 1.000 - - X1840
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.700

Return to query results.
Submit another query.