DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8128 and nudt6

DIOPT Version :9

Sequence 1:NP_001285282.1 Gene:CG8128 / 32504 FlyBaseID:FBgn0030668 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_004911171.1 Gene:nudt6 / 100494138 XenbaseID:XB-GENE-485555 Length:300 Species:Xenopus tropicalis


Alignment Length:290 Identity:98/290 - (33%)
Similarity:149/290 - (51%) Gaps:21/290 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 RAYSSSKTMDTPADVFRGITDRFAGVTVDGREE---NVDKSSFRDKLTKSLDFWTTNKNRAIWFR 113
            |.:.|..:...|:...||..|:|.||||  |.|   |:.:.:|...|.:|:..|..:...|:|..
 Frog    18 RHFCSQPSPAWPSVELRGKVDKFGGVTV--RLEPSHNLGEIAFGRWLHESVKQWRLDGRIAVWLH 80

  Fly   114 VYKEQADWVPILAENGFDFHHAKTGVVVMYRWLPEHESSNLPTYAHTLMGVGGLVINEQ-DEVLV 177
            :...|:..:...|..||.||||:.....:..||.: ..|.||.||...:||.|.|::|. .:|||
 Frog    81 IPIMQSRLISTAASEGFTFHHAEHNESTLTLWLKD-GPSRLPGYATHQVGVAGAVLDEDTGKVLV 144

  Fly   178 VSDRFAMIPNSWKLPGGYVEPRENLIDAAIREVAEETGIRTEFRSVVSLR--HAHGGTFGCSDMY 240
            |.||...: |:||.|||..:..|::...|:|||.|||||.:||:|::|:|  |.|.|.||.||:|
 Frog   145 VQDRNKTV-NAWKFPGGLSDQGEDIGATAVREVFEETGIHSEFKSLLSIRQQHNHPGAFGKSDLY 208

  Fly   241 VVIALKPLNLDFTRCEREIARIQWMPIAE--YLKHPQVHETNRQFVCTFLDYQKR----GLTLTC 299
            ::..||||:.....|.:|..:.:||.:.|  |..:..: .|:|........|.:.    .||:..
 Frog   209 IICRLKPLSHTINFCHQECLKCEWMDLRELAYCSNTTI-ITSRVAKLLLYGYNEGFHLVDLTMRT 272

  Fly   300 RDEVHQVLKKKYNLYYVDREQPQEQQDKKN 329
            ...|:..|  .|:||:  :|.|:..:...|
 Frog   273 FPAVYSGL--FYSLYH--KELPETYEGSAN 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8128NP_001285282.1 Nudix_Hydrolase_12 159..287 CDD:240027 52/132 (39%)
nudt6XP_004911171.1 Nudix_hydro 33..113 CDD:375717 25/81 (31%)
Nudix_Hydrolase_12 126..259 CDD:240027 52/134 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7395
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31425
Inparanoid 1 1.050 137 1.000 Inparanoid score I4432
OMA 1 1.010 - - QHG50265
OrthoDB 1 1.010 - - D516644at33208
OrthoFinder 1 1.000 - - FOG0002753
OrthoInspector 1 1.000 - - oto103183
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8980
SonicParanoid 1 1.000 - - X1840
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.010

Return to query results.
Submit another query.