DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8128 and nudt18

DIOPT Version :9

Sequence 1:NP_001285282.1 Gene:CG8128 / 32504 FlyBaseID:FBgn0030668 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_002932745.1 Gene:nudt18 / 100488091 XenbaseID:XB-GENE-6035439 Length:304 Species:Xenopus tropicalis


Alignment Length:56 Identity:24/56 - (42%)
Similarity:36/56 - (64%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 VGGLVINEQDEVLVVSDRFAMIPNSWKLPGGYVEPRENLIDAAIREVAEETGIRTE 219
            |.|:::||:||||::.:.......:|.||.|.:|.||.|::...|||.||||:..|
 Frog    44 VMGVLLNERDEVLMMQEAKPECRGTWYLPAGRLEKRETLMEGLCREVTEETGLTCE 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8128NP_001285282.1 Nudix_Hydrolase_12 159..287 CDD:240027 24/56 (43%)
nudt18XP_002932745.1 Nudix_Hydrolase 42..163 CDD:382015 24/56 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.