DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8128 and nudt6

DIOPT Version :9

Sequence 1:NP_001285282.1 Gene:CG8128 / 32504 FlyBaseID:FBgn0030668 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001082991.1 Gene:nudt6 / 100037370 ZFINID:ZDB-GENE-070410-44 Length:331 Species:Danio rerio


Alignment Length:204 Identity:84/204 - (41%)
Similarity:116/204 - (56%) Gaps:5/204 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 GITDRFAGVTVDGREENVDKSSFRDKLTKSLDFWTTNKNRAIWFRVYKEQADWVPILAENGFDFH 133
            |..|||.||||.....::.:..|.|.|..||..|.:....|:|..|...|:......|.:||.||
Zfish    66 GDVDRFGGVTVRDFPPDISEEEFSDLLKVSLHQWRSEGRVAVWLHVPISQSRVCSAAARHGFSFH 130

  Fly   134 HAKTGVVVMYRWLPEHESSNLPTYAHTLMGVGGLVINEQD-EVLVVSDRFAMIPNSWKLPGGYVE 197
            ||:....|:..||.|.: :.||.:|...:||.|.|::|.: :||||.|| ....|:||.|||..:
Zfish   131 HARGDQAVLSVWLAEGQ-NRLPAFATHQVGVAGAVLDESNGKVLVVQDR-NKTKNAWKFPGGLSD 193

  Fly   198 PRENLIDAAIREVAEETGIRTEFRSVVSLR--HAHGGTFGCSDMYVVIALKPLNLDFTRCEREIA 260
            ..||:.|.|:|||.||||:|:||||::|||  |.|.|.||.||:|::..|:||:.....|..|..
Zfish   194 LGENIADTAVREVFEETGVRSEFRSLLSLRQQHTHPGAFGMSDLYLICRLQPLSHRIHICTHECL 258

  Fly   261 RIQWMPIAE 269
            |..|:.:.|
Zfish   259 RCDWLDLRE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8128NP_001285282.1 Nudix_Hydrolase_12 159..287 CDD:240027 52/114 (46%)
nudt6NP_001082991.1 Nudix_Hydrolase_12 156..289 CDD:240027 52/113 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579699
Domainoid 1 1.000 96 1.000 Domainoid score I7313
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31425
Inparanoid 1 1.050 149 1.000 Inparanoid score I4362
OMA 1 1.010 - - QHG50265
OrthoDB 1 1.010 - - D516644at33208
OrthoFinder 1 1.000 - - FOG0002753
OrthoInspector 1 1.000 - - oto41744
orthoMCL 1 0.900 - - OOG6_103452
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1840
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.