DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8119 and zgc:152938

DIOPT Version :9

Sequence 1:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001070756.1 Gene:zgc:152938 / 768145 ZFINID:ZDB-GENE-061013-458 Length:292 Species:Danio rerio


Alignment Length:245 Identity:50/245 - (20%)
Similarity:88/245 - (35%) Gaps:76/245 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YPTNNLETNHLLREIALRPSIWDSRIKFSLRRPQIPIDWLDVSNAVGLGVDECKRRWKSLRNNYR 72
            :..|:::..|:.:..||                     |.:::..:|..||:.|.:||:||:.|.
Zfish    71 FDQNHIDYKHIDKREAL---------------------WQEIAEKIGFHVDDVKTKWKNLRDTYI 114

  Fly    73 TKIHQGNAW---------SWPHSKQMEFVRDVFPPHKPKTPARCRVQVKKS-----------KLI 117
            .|..:....         :|...|.|||:.      ......|....||:|           |.:
Zfish   115 RKKREDQCTGEQTPKKKKTWKFMKMMEFLA------TSSEQRRVHSSVKESADEVGDGSESEKSL 173

  Fly   118 LHPQQYLQSVASYSAFKKGGIEFEAEERLFLVTDEPAF-----------DLDVDEEVTRLLGTDQ 171
                    |::..||.....::..:::|...||  |.|           |.:.:|...:.:..|.
Zfish   174 --------SISVESAVSSEPVQANSKKRKRSVT--PDFVEKYLAAKEVRDREREECRKQRMEDDI 228

  Fly   172 WLWQTNLDFILLPIFRAPPPSAMAKISNESNRHFLLSMVPMLRSLSDRSK 221
            .|:..:    |.|:.|..|||..:.:  :...|.:|..|..  .|||.|:
Zfish   229 SLFLMS----LAPVIRRLPPSKQSSV--KMRFHQVLHEVEY--GLSDASQ 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8119NP_573050.1 MADF 17..97 CDD:214738 19/88 (22%)
BESS 201..234 CDD:281011 7/21 (33%)
zgc:152938NP_001070756.1 MADF_DNA_bdg 60..128 CDD:287510 15/77 (19%)
BESS 226..260 CDD:281011 10/39 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.