DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8119 and si:ch211-207i20.3

DIOPT Version :9

Sequence 1:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_683419.5 Gene:si:ch211-207i20.3 / 555734 ZFINID:ZDB-GENE-141222-71 Length:263 Species:Danio rerio


Alignment Length:262 Identity:48/262 - (18%)
Similarity:92/262 - (35%) Gaps:99/262 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ADNK--YPTNNLETNHLLREIALRPSIWDSRIKFSLRRPQIPIDWLDVSNAVGLGVDECKRRWKS 66
            ::||  :..|:.|..:..|:.||                     |..:::.:|:.|:|.|.:||:
Zfish    40 SENKELFDKNHSEYKNTKRKEAL---------------------WQGIADKMGVDVEEVKAKWKN 83

  Fly    67 LRNNY--RTKIHQGNAWS---------WPHSKQMEFVRDVFPPHKPKTPARCRV---QVKKSKLI 117
            ||:.|  :.::.|..:.|         |.:.:.|:|:       .|.|..|..:   :::..:  
Zfish    84 LRDTYTRKKRLEQDGSRSGRAAKKKKQWKYMRVMDFL-------DPATEHRSGILDSKIEDDE-- 139

  Fly   118 LHPQQYL----------QSVASYSAFKKGGIEFEAEERL-----FLVTDEPAFDLDVDEEVTRLL 167
              |.:..          .||.|..|.:...::....|.|     :|.|.: |.|.:.||:     
Zfish   140 --PDEDSGAEPASTSTGTSVTSPEAMRSSIVKRRRSETLELLEKYLATKD-AKDREKDEQ----- 196

  Fly   168 GTDQWLWQTNLDFILLPIFRAPPPSAMAKISNESNRHFLLSMVPMLRSLSDRSKERFRSWTRRVL 232
                  .|..:|.                        ||.|:.|.||.|....:...:...:::|
Zfish   197 ------QQDEVDL------------------------FLRSLAPALRRLPASKQSLVKLQIQKIL 231

  Fly   233 RE 234
            .:
Zfish   232 HD 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8119NP_573050.1 MADF 17..97 CDD:214738 18/90 (20%)
BESS 201..234 CDD:281011 8/32 (25%)
si:ch211-207i20.3XP_683419.5 MADF 35..122 CDD:214738 22/109 (20%)
BESS 199..233 CDD:308542 9/57 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.