DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8119 and hng1

DIOPT Version :9

Sequence 1:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster


Alignment Length:257 Identity:52/257 - (20%)
Similarity:110/257 - (42%) Gaps:54/257 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LETNH---------LLREIALRPSIWDSRI---KFSLRRPQIPIDWLDVSNAVGLGVDECKRRWK 65
            :.:||         |::.|...||::|.::   :.|.|:.:   ||..|::.:.:.:.:.:|||.
  Fly     1 MSSNHRPLDDSDILLIQTIRETPSLYDPQLPSFRLSQRKEE---DWAKVADLLNISISDARRRWT 62

  Fly    66 SLRNNYRTKIHQGN---AWSWPHS---KQMEFVRDVFPPHK----------PKTPARCRVQV--- 111
            .||:.|..::.|..   :..:.|:   ::|:|:||.....:          .|.....:|.:   
  Fly    63 CLRDRYSRELKQKRLHPSGEFGHNDFFRKMDFLRDFVRKRRERRGRERDREQKPTGWMKVDLQRR 127

  Fly   112 KKSKLILHPQQYLQSVASYSAFKKGGIEFEAEERL-FLVTDEPAFDLDVD---------EEVTRL 166
            ::::|.:..:..::...|: |:.:|..:.:.:.:| ...|....:.:.|:         |.....
  Fly   128 RRTRLPIDTETLIEEQGSH-AYDEGEEQHDYDAKLESHTTQSETYSVVVEADDGQEPEQESFDEF 191

  Fly   167 LGTDQWLWQTNLDFILLPIFRAP-PPSAMAKI-SNESNRHFLLSMVPMLRSLSDRSKERFRS 226
            || |....|......:.|...|| ..||...| ||.::.::|:.|.|      :.::||..|
  Fly   192 LG-DAECEQKVKVVTIHPEIAAPNATSAPEPIESNHADLNYLVCMPP------NANQEREHS 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8119NP_573050.1 MADF 17..97 CDD:214738 23/97 (24%)
BESS 201..234 CDD:281011 6/26 (23%)
hng1NP_611558.2 MADF 15..98 CDD:214738 21/85 (25%)
BESS 264..298 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.