DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8119 and CG7745

DIOPT Version :9

Sequence 1:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_610671.1 Gene:CG7745 / 36210 FlyBaseID:FBgn0033616 Length:506 Species:Drosophila melanogaster


Alignment Length:60 Identity:19/60 - (31%)
Similarity:31/60 - (51%) Gaps:5/60 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 WLDVSNAVGLGVDECKRRWKSLRNNYRTKIHQGNA-----WSWPHSKQMEFVRDVFPPHK 100
            |..::..:...||.||:|||.||..|.::..||:.     .|.|:.::|:|:.....|.|
  Fly    40 WQLIAMKLRTDVDTCKKRWKYLRERYVSQRKQGDPPVYEHLSRPYLEKMKFLDQHIQPRK 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8119NP_573050.1 MADF 17..97 CDD:214738 17/55 (31%)
BESS 201..234 CDD:281011
CG7745NP_610671.1 MADF 5..96 CDD:214738 17/55 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.