powered by:
Protein Alignment CG8119 and CG7745
DIOPT Version :9
Sequence 1: | NP_573050.1 |
Gene: | CG8119 / 32500 |
FlyBaseID: | FBgn0030664 |
Length: | 244 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_610671.1 |
Gene: | CG7745 / 36210 |
FlyBaseID: | FBgn0033616 |
Length: | 506 |
Species: | Drosophila melanogaster |
Alignment Length: | 60 |
Identity: | 19/60 - (31%) |
Similarity: | 31/60 - (51%) |
Gaps: | 5/60 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 WLDVSNAVGLGVDECKRRWKSLRNNYRTKIHQGNA-----WSWPHSKQMEFVRDVFPPHK 100
|..::..:...||.||:|||.||..|.::..||:. .|.|:.::|:|:.....|.|
Fly 40 WQLIAMKLRTDVDTCKKRWKYLRERYVSQRKQGDPPVYEHLSRPYLEKMKFLDQHIQPRK 99
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG8119 | NP_573050.1 |
MADF |
17..97 |
CDD:214738 |
17/55 (31%) |
BESS |
201..234 |
CDD:281011 |
|
CG7745 | NP_610671.1 |
MADF |
5..96 |
CDD:214738 |
17/55 (31%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR12243 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.