DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8119 and CG10949

DIOPT Version :9

Sequence 1:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster


Alignment Length:159 Identity:32/159 - (20%)
Similarity:58/159 - (36%) Gaps:41/159 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LETNHLLREIALRPSIWDSRIKFSLRR-PQIPIDWLDVSNAVGLGVDECKRRWKSLRNNY----- 71
            ::.:.|::.|...|.::|.....|::. .|....|..:|..:|.....|..||||:|:.:     
  Fly     1 MDDDELIKLIERHPILYDKDCARSVKNAAQKDAAWKAISQKLGASERACITRWKSIRDRFGKEFR 65

  Fly    72 RTKIHQGNAWSWPHSKQMEFVRDVFPPHKPKTPARCRVQVKKSKLILHPQQYLQSVASYSAFKKG 136
            |.:........|          |:||                 :|:.....|.|.:|...:.  .
  Fly    66 RFQERPDEPTYW----------DMFP-----------------RLLFLKDHYKQGLARNESL--D 101

  Fly   137 GIEFEAEERLFLVTDEPAFDLDVDEEVTR 165
            |:.||..||      :....:|:::|..|
  Fly   102 GMRFEPRER------KKRTKVDMEQERRR 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8119NP_573050.1 MADF 17..97 CDD:214738 18/85 (21%)
BESS 201..234 CDD:281011
CG10949NP_001286101.1 MADF 5..91 CDD:214738 21/112 (19%)
MADF 140..226 CDD:214738
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.