DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8119 and brwl

DIOPT Version :9

Sequence 1:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_609298.1 Gene:brwl / 34275 FlyBaseID:FBgn0032130 Length:435 Species:Drosophila melanogaster


Alignment Length:210 Identity:40/210 - (19%)
Similarity:62/210 - (29%) Gaps:63/210 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ADNKYPTNNLETNHLLREIALRPSIWDSRIKFSLRRPQIPIDWLDVSNAVGLGVDECKRRWKSLR 68
            ||..:   |:...:|:|   ....::|.::.....|......|:.:|......|..||.||::||
  Fly    53 ADEDF---NIRFVNLVR---THKCLYDKKVPEYRNRDNQEKAWVLISKETRESVIHCKERWRNLR 111

  Fly    69 NNYRTKIHQGNAWSWPHSKQMEFVRDVFPPHKP-----------------------KTPARCRVQ 110
            ......|.|.:...              |.|||                       ........|
  Fly   112 ACLSRYIKQQSGSE--------------PQHKPYYLTEHMAFLLPFLKSSRNSLEGNNSLATLYQ 162

  Fly   111 VKKSKL-----ILHPQQYLQSVASYSAFKK-----------GGIEFEAEERLFLVT---DEPAFD 156
            :.:..|     :|||..:......|.|...           .|...|..|..:.::   ||...|
  Fly   163 MSQQHLQHQPFLLHPALHATEEHKYCANTSINNNNNNNDVHNGESMEVLEMKYSISEKDDEETID 227

  Fly   157 LDVDEEVTRLLGTDQ 171
            . .|..||..||.::
  Fly   228 A-FDPAVTNTLGMNR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8119NP_573050.1 MADF 17..97 CDD:214738 15/79 (19%)
BESS 201..234 CDD:281011
brwlNP_609298.1 MADF 60..145 CDD:214738 19/101 (19%)
BESS 356..389 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.