DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8119 and CG11723

DIOPT Version :9

Sequence 1:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001259906.1 Gene:CG11723 / 33388 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster


Alignment Length:283 Identity:69/283 - (24%)
Similarity:113/283 - (39%) Gaps:68/283 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLREIALRPSIWDSRIKFSLRRPQIPIDWLDVSNAVGLGVDECKRRWKSLRNNYRT---KIHQG- 78
            |::|::.|..:||:.:..|.|.....:.|..|:..:...|..||:|:|.:|::||.   ||.|. 
  Fly     8 LIQEVSKRRCLWDTNMSISYRNQDAALQWASVAQIMQQDVSICKKRFKGMRDSYRAEVRKIQQKR 72

  Fly    79 -NAWSWPHSKQMEFVRDVFPPHK----PKTPARCRVQVKKSKLILHPQQYLQSVASYSAFKKGGI 138
             ....||:.:.:||:|.:|.|..    |..|.   |...:...:..|.:.:.............:
  Fly    73 IEMSHWPYFRSLEFMRQIFDPEGLVPFPPEPF---VMNTEQPEVFEPTRLVDFAIDLDLDNDDSV 134

  Fly   139 EFEAEERLFLVTDEPAFDLD-----------VDEEVTRLLGTDQWLWQTNLDFILLPIF------ 186
            :||..|.:|  ..||:...|           :|...:....:||.|..|      |||.      
  Fly   135 DFEIIEDIF--KREPSVPQDSGSDKGSLIKPLDSSSSGAHRSDQDLSPT------LPIHLPRHQQ 191

  Fly   187 ---RAPPPSAMAK----------------------------ISNESNRHFLLSMVPMLRSLSDRS 220
               |.||||...:                            :.|:|:..||:||:|.::|||..|
  Fly   192 FLPRPPPPSKRGRRRKTSPSNDVPLLNGYASQASKSTTEPDLKNDSDLSFLMSMMPHVKSLSAIS 256

  Fly   221 KERFRSWTRRVLREMLIAEKKLL 243
            ..:||....|||.|:...::.:|
  Fly   257 NLKFRMEMARVLVELREEDQHML 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8119NP_573050.1 MADF 17..97 CDD:214738 25/83 (30%)
BESS 201..234 CDD:281011 15/32 (47%)
CG11723NP_001259906.1 MADF 7..91 CDD:214738 25/82 (30%)
BESS 236..270 CDD:281011 15/33 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103389at6656
OrthoFinder 1 1.000 - - FOG0016965
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.