DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8119 and LOC3291373

DIOPT Version :10

Sequence 1:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_061515666.1 Gene:LOC3291373 / 3291373 VectorBaseID:AGAMI1_008590 Length:272 Species:Anopheles gambiae


Alignment Length:36 Identity:8/36 - (22%)
Similarity:14/36 - (38%) Gaps:11/36 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   528 RGCADNWSLINEVERFDPEKRAWEIISCSGPMVGAG 563
            |||..:|..:.|.       ..|.::.    ::|.|
Mosquito   389 RGCLMDWKTMQET-------FPWSVVL----LLGGG 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8119NP_573050.1 MADF 17..97 CDD:214738
BESS 201..234 CDD:460758
LOC3291373XP_061515666.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.