Sequence 1: | NP_573050.1 | Gene: | CG8119 / 32500 | FlyBaseID: | FBgn0030664 | Length: | 244 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_572838.2 | Gene: | CG4404 / 32241 | FlyBaseID: | FBgn0030432 | Length: | 308 | Species: | Drosophila melanogaster |
Alignment Length: | 288 | Identity: | 50/288 - (17%) |
---|---|---|---|
Similarity: | 93/288 - (32%) | Gaps: | 107/288 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 RPSIWDSRIKFSLRRPQIPIDWLDVSNAVGLGVDECKRRWKSLRNNY-------RTKIHQGNAWS 82
Fly 83 WPHSKQMEFVRDVFPPHKPKTPAR-CRVQVKKSKLILHPQQYLQSVASYSAFKKGGIEFEAEERL 146
Fly 147 FLVTDEPAFDLDVDEEVTR---------------------------------------------- 165
Fly 166 ---LLGT-------DQW----------LWQTNLDFILLPIFRAPPP----SAMAKISN------- 199
Fly 200 --ESNRHFLLSMVPMLRSLSDRSKERFR 225 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8119 | NP_573050.1 | MADF | 17..97 | CDD:214738 | 16/78 (21%) |
BESS | 201..234 | CDD:281011 | 6/25 (24%) | ||
CG4404 | NP_572838.2 | MADF | 17..103 | CDD:214738 | 17/85 (20%) |
BESS | 267..301 | CDD:281011 | 6/26 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR12243 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |