DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8119 and CG4404

DIOPT Version :9

Sequence 1:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster


Alignment Length:288 Identity:50/288 - (17%)
Similarity:93/288 - (32%) Gaps:107/288 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RPSIWDSRIKFSLRRPQIPIDWLDVSNAVGLGVDECKRRWKSLRNNY-------RTKIHQGNAWS 82
            :|.:|:.......::..:...|..|:|.:...|..|:.||:::|:::       ||:..:|.. .
  Fly    25 QPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSFLRSLKLARTQTGRGKR-K 88

  Fly    83 WPHSKQMEFVRDVFPPHKPKTPAR-CRVQVKKSKLILHPQQYLQSVASYSAFKKGGIEFEAEERL 146
            :..||.::|:       .|.|.:| |..|:        |...|:.....:..::......|||..
  Fly    89 YYLSKYLQFL-------VPFTKSRSCHKQL--------PGMVLRKPGQAATAQQEDEVVAAEEEA 138

  Fly   147 FLVTDEPAFDLDVDEEVTR---------------------------------------------- 165
            .:...|...|:.|.||..|                                              
  Fly   139 KVSDGEMPLDVQVSEEEHRRNQEQDREQPTACLPLRLHSIKVEHDSSNANQQLERMVSQQSLVSV 203

  Fly   166 ---LLGT-------DQW----------LWQTNLDFILLPIFRAPPP----SAMAKISN------- 199
               .||.       .||          |..|.    ..|....|||    ||::..:.       
  Fly   204 PAAALGNHLGWSDLTQWFKGHGSGHHKLTTTT----TTPTSPPPPPQPATSALSVFTGGPGGGGS 264

  Fly   200 --ESNRHFLLSMVPMLRSLSDRSKERFR 225
              :::..||:|:.|.::.::.:...:||
  Fly   265 QPDADYSFLISLHPYIKEMNGKQNRKFR 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8119NP_573050.1 MADF 17..97 CDD:214738 16/78 (21%)
BESS 201..234 CDD:281011 6/25 (24%)
CG4404NP_572838.2 MADF 17..103 CDD:214738 17/85 (20%)
BESS 267..301 CDD:281011 6/26 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.