DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8119 and CG45071

DIOPT Version :9

Sequence 1:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_730024.1 Gene:CG45071 / 19834908 FlyBaseID:FBgn0266441 Length:429 Species:Drosophila melanogaster


Alignment Length:246 Identity:52/246 - (21%)
Similarity:86/246 - (34%) Gaps:59/246 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KYPTNNLETNHLLREIALRPSIWDSRIKFSLRRPQIPIDWLDVSNAVGLGVDECKRRWKSLRNNY 71
            |..|..|.....:.:|..||:||:.  .|...:..:...|.::|.|..|.....|.:||.||:|:
  Fly     4 KKSTIVLNVEQFIHDIEERPAIWNR--NFHCNKAFLEQMWDELSGAHKLPKIVLKAKWKGLRDNF 66

  Fly    72 RT------KIHQGNAW--------SWPHSKQMEFVRDVFPPHKPKTPARCRVQVKKSKLILHPQQ 122
            |.      :...|:..        .|.|...:.|:.|......||..              ..|.
  Fly    67 RVEYKRIPRADNGDFMVDPATFESKWLHYYALLFLTDHMRHRLPKNE--------------QDQS 117

  Fly   123 YLQSVASYSAFKKGGIEFEAEERLFLVTDEPAFDLDVDEEVTRLLG--TDQWLWQTNLDFILLPI 185
            :..|..|... :|..:|.:....|.....:.  |.|.|||.....|  ::..:.:|      :| 
  Fly   118 FYFSQQSEDC-EKTVVEPDLTNGLIRRLQDS--DEDYDEEEMEADGEASEATMEET------MP- 172

  Fly   186 FRAPPPSA--MAKIS------------NESNRHFLLSMVPMLRSLSDRSKE 222
               .||:|  |.::|            .|:::|.|:....:...|.:..||
  Fly   173 ---TPPAAHQMNQVSTTPLATGALRAQEEAHQHALIKAGLLRAQLMELEKE 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8119NP_573050.1 MADF 17..97 CDD:214738 22/93 (24%)
BESS 201..234 CDD:281011 5/22 (23%)
CG45071NP_730024.1 MADF 14..106 CDD:214738 22/93 (24%)
BESS 384..418 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103389at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.