DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8119 and madf-5

DIOPT Version :10

Sequence 1:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_497028.1 Gene:madf-5 / 175118 WormBaseID:WBGene00007242 Length:423 Species:Caenorhabditis elegans


Alignment Length:92 Identity:20/92 - (21%)
Similarity:40/92 - (43%) Gaps:18/92 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLREIALRPSIWDSRIKFS---LRRPQIPIDWLDVSNAV--GLGVDECKRRWKSLRNNYR--TKI 75
            |:.|:...|.:::...:.|   :.|.::   |..::..:  ....:..|:||..||:.||  .||
 Worm    11 LINEVRKYPCLYNHSRRGSGDTMERQRL---WESIAKNIDPNCAAEFAKKRWLQLRDRYRKELKI 72

  Fly    76 HQGNAW----SWPHSKQME----FVRD 94
            ...|.:    .|.:..|:.    |::|
 Worm    73 AIKNGFVTPVRWCYFNQLSWLDPFLKD 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8119NP_573050.1 MADF 17..97 CDD:214738 20/92 (22%)
BESS 201..234 CDD:460758
madf-5NP_497028.1 MADF 10..98 CDD:214738 19/89 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.