DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8119 and LOC110439798

DIOPT Version :9

Sequence 1:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_021332041.1 Gene:LOC110439798 / 110439798 -ID:- Length:273 Species:Danio rerio


Alignment Length:266 Identity:62/266 - (23%)
Similarity:103/266 - (38%) Gaps:88/266 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NNLETNHLLREIALRPSIWDSRIKFSLRRPQIPIDWLDVSNAVGLGVDECKRRWKSLRNNY---- 71
            |.|.|::...|                ||.::   |.||:.::||.|.|||||||::|:.|    
Zfish    44 NRLRTDYRSTE----------------RRERV---WRDVAASIGLSVVECKRRWKTIRDRYIRER 89

  Fly    72 ----------RTKIHQGNAWSWPHSKQMEFVRDVFPPH--KPKTPARCRVQVKKSKLILHPQQYL 124
                      ..::|.     |||.:.:.|:    ..|  |.:.|:..:          .|::..
Zfish    90 RLCKLKKDLGGRRLHY-----WPHRESLAFL----DAHIRKRRRPSGAQ----------GPEEEQ 135

  Fly   125 QSVASYSAFKKGGIEFEAEERLFLVTDEPAF-------DLDVDEEVTRLLGTDQW--LWQTNL-- 178
            |...|.:|.::...|...||   .|:|...|       .|.:   ||:|....|.  |..|:|  
Zfish   136 QEEHSSAALQEDKEECVQEE---CVSDSSRFVSPLNPLPLSI---VTQLKPVPQVSPLLLTSLPP 194

  Fly   179 DFILLPIFRAPPP----SAMAKISN-------------ESNRHFLLSMVPMLRSLSDRSKERFRS 226
            ...:.|...:.||    ||.|...|             :.::.||||.||.|:.|:.:.:...:.
Zfish   195 GLKVAPASSSAPPLLPASASAGPLNVPLEEQQRADGALDEDQLFLLSYVPALKRLTPQKRAAVKM 259

  Fly   227 WTRRVL 232
            ..::::
Zfish   260 QIQQIM 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8119NP_573050.1 MADF 17..97 CDD:214738 23/93 (25%)
BESS 201..234 CDD:281011 8/32 (25%)
LOC110439798XP_021332041.1 MADF 32..120 CDD:214738 27/103 (26%)
BESS 233..267 CDD:308542 8/33 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.