DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8119 and si:zfos-128g4.1

DIOPT Version :9

Sequence 1:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_002661969.1 Gene:si:zfos-128g4.1 / 100334256 ZFINID:ZDB-GENE-141212-382 Length:248 Species:Danio rerio


Alignment Length:229 Identity:51/229 - (22%)
Similarity:91/229 - (39%) Gaps:67/229 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 WLDVSNAVGLGVDECKRRWKSLRNNY--------------RTKIHQGNAWSWPHSKQMEFVRDVF 96
            |.:|:.:|||.|.|||||||::|:.|              ..::|.     |||.:.:.|:    
Zfish    37 WREVAASVGLSVVECKRRWKTIRDRYIRERRLCKLKKDLGGRRLHY-----WPHRESLAFL---- 92

  Fly    97 PPH--KPKTPARCRVQVKKSKLILHPQQYLQSVASYSAFKKGGIEFEAEE------RL------- 146
            ..|  |.:.|:..:          .|::..|...|.:|.::.. |..:||      ||       
Zfish    93 DAHIRKRRRPSGAQ----------GPEEEQQEEHSSAALQEDK-ECVSEECVDSGSRLAVSPLPV 146

  Fly   147 FLVTDEPAFDLDVDEEVTRLLGTDQWLWQTNLDFILLPIFRAPPPSAMAKISN------------ 199
            .:::..|...|....:|:.||     |........:.|:..:...||.|...|            
Zfish   147 SIMSAPPPPQLKAVPQVSPLL-----LAALPPGLKVAPVCSSATGSASAGPLNVPLEEQQRADGA 206

  Fly   200 -ESNRHFLLSMVPMLRSLSDRSKERFRSWTRRVL 232
             :.::.||||.||.|:.|:.:.:...:...::::
Zfish   207 LDEDQLFLLSYVPALKRLTPQKRAAVKMQIQQIM 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8119NP_573050.1 MADF 17..97 CDD:214738 20/64 (31%)
BESS 201..234 CDD:281011 8/32 (25%)
si:zfos-128g4.1XP_002661969.1 MADF 8..97 CDD:214738 21/68 (31%)
BESS 208..242 CDD:281011 8/33 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.