DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8119 and LOC100330838

DIOPT Version :9

Sequence 1:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001373242.1 Gene:LOC100330838 / 100330838 -ID:- Length:204 Species:Danio rerio


Alignment Length:262 Identity:54/262 - (20%)
Similarity:84/262 - (32%) Gaps:115/262 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLREIALRPSIWDSRI---KFSLRRPQIPIDWLDVSNAVGLGVDECKRRWKSLRNNY-------- 71
            |:..::..|.:::|.|   |.:.|:.:.   |..||..|.:..::|:|||||||:.:        
Zfish     9 LIAAVSDYPELYNSTINSYKDAARKAKA---WRAVSLQVEIPEEDCRRRWKSLRDMFIKDKRAEQ 70

  Fly    72 RTKIHQGNAWSWPHSKQMEFVRDVFPPHKPKTPARCRVQVKKSKLILHPQQYLQSVASYSAFKKG 136
            |.:....:..||.:|.||.|:          ||                  ::||.:        
Zfish    71 RRRASGTSHRSWKYSWQMSFL----------TP------------------FIQSRS-------- 99

  Fly   137 GIEFEAEERLFLVTDEPAFDL---DVDEEVT-----------------RLLGTD----------- 170
                       |..|||..|.   |.|||.|                 .|.|..           
Zfish   100 -----------LAADEPEEDRDDEDKDEERTADGNSAFVVQDFEGDHGMLDGASHYSASGSQGSG 153

  Fly   171 ---QWLWQTNLDFILLPIFRAPPPSAMAKISNESNRHFLLSMVPMLRSLSDRSKERFRSWTRRVL 232
               :|..:.|.|.                    .:..||.|::|.||.|....|...:....::|
Zfish   154 RKRKWHMEANEDL--------------------EDEMFLFSLLPYLRRLPYAKKSAVKLKIHQLL 198

  Fly   233 RE 234
            .|
Zfish   199 YE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8119NP_573050.1 MADF 17..97 CDD:214738 25/89 (28%)
BESS 201..234 CDD:281011 9/32 (28%)
LOC100330838NP_001373242.1 MADF 8..96 CDD:214738 27/117 (23%)
BESS 167..200 CDD:397204 9/32 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.