Sequence 1: | NP_573050.1 | Gene: | CG8119 / 32500 | FlyBaseID: | FBgn0030664 | Length: | 244 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001373242.1 | Gene: | LOC100330838 / 100330838 | -ID: | - | Length: | 204 | Species: | Danio rerio |
Alignment Length: | 262 | Identity: | 54/262 - (20%) |
---|---|---|---|
Similarity: | 84/262 - (32%) | Gaps: | 115/262 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 LLREIALRPSIWDSRI---KFSLRRPQIPIDWLDVSNAVGLGVDECKRRWKSLRNNY-------- 71
Fly 72 RTKIHQGNAWSWPHSKQMEFVRDVFPPHKPKTPARCRVQVKKSKLILHPQQYLQSVASYSAFKKG 136
Fly 137 GIEFEAEERLFLVTDEPAFDL---DVDEEVT-----------------RLLGTD----------- 170
Fly 171 ---QWLWQTNLDFILLPIFRAPPPSAMAKISNESNRHFLLSMVPMLRSLSDRSKERFRSWTRRVL 232
Fly 233 RE 234 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8119 | NP_573050.1 | MADF | 17..97 | CDD:214738 | 25/89 (28%) |
BESS | 201..234 | CDD:281011 | 9/32 (28%) | ||
LOC100330838 | NP_001373242.1 | MADF | 8..96 | CDD:214738 | 27/117 (23%) |
BESS | 167..200 | CDD:397204 | 9/32 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1634040at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |