DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and MED26

DIOPT Version :9

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_004822.2 Gene:MED26 / 9441 HGNCID:2376 Length:600 Species:Homo sapiens


Alignment Length:82 Identity:24/82 - (29%)
Similarity:33/82 - (40%) Gaps:14/82 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LLGQITPEELSKMTPEEMASDDMKQMRQKYVQDSINAAQMAKVQGTKTDQFKCERCDKRNCSQL- 138
            |:.|..|.:|..:| .|:..||:         |.|.|:|...|.|.:..|...  .|...|..| 
Human   531 LVPQSPPTDLPGLT-REVTQDDL---------DRIQASQWPGVNGCQDTQGNW--YDWTQCISLD 583

  Fly   139 -HIRDGDEPIITFVICD 154
             |..||...|:.:|..|
Human   584 PHGDDGRLNILPYVCLD 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 9/33 (27%)
Zn-ribbon 118..161 CDD:295390 11/39 (28%)
MED26NP_004822.2 TFS2N 12..86 CDD:197766
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 99..330
Med26_M 177..417 CDD:292322
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..402
Med26_C 419..598 CDD:292321 22/78 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 431..461
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.