DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and DST1

DIOPT Version :9

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_011472.1 Gene:DST1 / 852839 SGDID:S000003011 Length:309 Species:Saccharomyces cerevisiae


Alignment Length:164 Identity:53/164 - (32%)
Similarity:82/164 - (50%) Gaps:13/164 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KCREMLATAL-----KSGNMPPGCGDPDDMAAKLEDAIYGDLNGC---KVKYKNRIRSRLANLRD 64
            |.|:.:..||     |....||   ......||..::....:|.|   :..||.|.|...:|:..
Yeast   147 KLRDQVLKALYDVLAKESEHPP---QSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVIS 208

  Fly    65 PKNPELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQKYVQDSINAAQMAKVQGTKTDQFKCER 129
            ..||:|:.|...|.||||.|:....:::|...:||..::..:.::..||.|.::.:.||:|.|.:
Yeast   209 KNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATIERSVTDRFTCGK 273

  Fly   130 CDKRNCS--QLHIRDGDEPIITFVICDECGNRWK 161
            |.::..|  ||..|..|||:.||..|:.||||||
Yeast   274 CKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 29/108 (27%)
Zn-ribbon 118..161 CDD:295390 19/44 (43%)
DST1NP_011472.1 TFSII 3..309 CDD:273592 53/164 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I1263
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001112
OrthoInspector 1 1.000 - - otm46625
orthoMCL 1 0.900 - - OOG6_101177
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2312
SonicParanoid 1 1.000 - - X770
TreeFam 1 0.960 - -
109.750

Return to query results.
Submit another query.