powered by:
Protein Alignment CG8117 and RPB9
DIOPT Version :9
Sequence 1: | NP_573049.2 |
Gene: | CG8117 / 32499 |
FlyBaseID: | FBgn0030663 |
Length: | 162 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_011445.1 |
Gene: | RPB9 / 852810 |
SGDID: | S000003038 |
Length: | 122 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 40 |
Identity: | 9/40 - (22%) |
Similarity: | 16/40 - (40%) |
Gaps: | 10/40 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 133 RNCSQLHIRDG----------DEPIITFVICDECGNRWKS 162
|.|.:.|.|:. |..::.|.:|..|.:.:.|
Yeast 73 RECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTS 112
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG8117 | NP_573049.2 |
TFIIS_M |
3..109 |
CDD:284835 |
|
Zn-ribbon |
118..161 |
CDD:295390 |
8/37 (22%) |
RPB9 | NP_011445.1 |
RPB9 |
3..113 |
CDD:224510 |
9/40 (23%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1594 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.