DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and AT5G42325

DIOPT Version :9

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_680377.1 Gene:AT5G42325 / 834238 AraportID:AT5G42325 Length:233 Species:Arabidopsis thaliana


Alignment Length:96 Identity:33/96 - (34%)
Similarity:48/96 - (50%) Gaps:22/96 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EMLATALKSGNMPPGCGDPDDMAAKLEDAIYGDLNGCKVKYKNRIRSRLANLRDPKNPELRQKFL 75
            |::.|.:|...|.. | ||..:|..:|.|:                |.|.|:.|..||:||:|.|
plant   134 EVVDTEMKRRVMTV-C-DPWVVAVSVESAM----------------SILFNMGDSNNPDLRRKVL 180

  Fly    76 LGQITPEELSKMTPEEMASDDMKQMRQKYVQ 106
            :|:|:.|.|.||..:||.|:.:    ||.||
plant   181 IGEISGERLVKMEKDEMGSEKI----QKEVQ 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 33/96 (34%)
Zn-ribbon 118..161 CDD:295390
AT5G42325NP_680377.1 TFIIS_I 11..85 CDD:238107
TFIIS_M 118..208 CDD:295406 33/96 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1579101at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.