DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and AT4G18720

DIOPT Version :9

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_193607.1 Gene:AT4G18720 / 827606 AraportID:AT4G18720 Length:266 Species:Arabidopsis thaliana


Alignment Length:118 Identity:43/118 - (36%)
Similarity:59/118 - (50%) Gaps:21/118 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RIKCREMLATAL----------KSGNMPPGCGDPDDMAAKLEDAIYGDLNGC-----KVKYKNRI 55
            |.|.||:|.|:|          :.......| ||..:|..:|.|::.:| ||     |.||    
plant   118 RDKVREILQTSLAKVASEVVDTEMKTRVTAC-DPWVVAVSVETAMFENL-GCFMGPQKAKY---- 176

  Fly    56 RSRLANLRDPKNPELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQKYVQDS 108
            ||.|.|:.|..||:||:|.|||:|:.|.|.||..|||.|......|:..:.:|
plant   177 RSILFNMGDSNNPDLRRKVLLGEISGERLVKMEKEEMGSSWYTNSRRNPLYES 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 43/118 (36%)
Zn-ribbon 118..161 CDD:295390
AT4G18720NP_193607.1 TFIIS_I 11..87 CDD:238107
TFS2M 119..224 CDD:128786 41/110 (37%)
PKc_like <231..248 CDD:304357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.