DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and TFIIS

DIOPT Version :9

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_181390.1 Gene:TFIIS / 818438 AraportID:AT2G38560 Length:378 Species:Arabidopsis thaliana


Alignment Length:171 Identity:60/171 - (35%)
Similarity:88/171 - (51%) Gaps:18/171 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IRIKCREMLATAL------------KSGNMPPGCGDPDDMAAKLEDAIYGDLNGCKVKYKNRIRS 57
            :|.|.||:|..||            :|.|    ..||..:|..:|..::..|.......|.:.||
plant   210 VRDKIRELLVEALCRVAGEADDYERESVN----ASDPLRVAVSVESLMFEKLGRSTGAQKLKYRS 270

  Fly    58 RLANLRDPKNPELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQKYVQDSINAAQMAKVQGTKT 122
            .:.||||..||:||::.|.|:|:||:|..::.|:||||..||...:..:.::...:........|
plant   271 IMFNLRDSNNPDLRRRVLTGEISPEKLITLSAEDMASDKRKQENNQIKEKALFDCERGLAAKAST 335

  Fly   123 DQFKCERCDKRNCS--QLHIRDGDEPIITFVICDECGNRWK 161
            |||||.||.:|.|:  |:..|..|||:.|:|.|..|.|.||
plant   336 DQFKCGRCGQRKCTYYQMQTRSADEPMTTYVTCVNCDNHWK 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 38/115 (33%)
Zn-ribbon 118..161 CDD:295390 20/44 (45%)
TFIISNP_181390.1 TFSII 21..378 CDD:273592 60/171 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 135 1.000 Inparanoid score I1834
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1579101at2759
OrthoFinder 1 1.000 - - FOG0001112
OrthoInspector 1 1.000 - - mtm1141
orthoMCL 1 0.900 - - OOG6_101177
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X770
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.