DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and Polr2i

DIOPT Version :9

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_081535.1 Gene:Polr2i / 69920 MGIID:1917170 Length:125 Species:Mus musculus


Alignment Length:81 Identity:17/81 - (20%)
Similarity:34/81 - (41%) Gaps:16/81 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 LSKMTPEEMASDDMKQMRQKYVQDSINAAQMAKVQGTKTDQFKCERCDKRNC--SQLHIRDGDEP 146
            ::|:|.|   .|::.|:.....||...         .:|:...|::|..:..  .|.|....::.
Mouse    55 VNKITHE---VDELTQIIADVSQDPTL---------PRTEDHPCQKCGHKEAVFFQSHSARAEDA 107

  Fly   147 IITFVIC--DECGNRW 160
            :..:.:|  ..||:||
Mouse   108 MRLYYVCTAPHCGHRW 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 7/24 (29%)
Zn-ribbon 118..161 CDD:295390 10/47 (21%)
Polr2iNP_081535.1 RPB9 14..125 CDD:224510 17/81 (21%)
Zn-ribbon_RPB9 74..124 CDD:259793 12/59 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.