DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and TCEA2

DIOPT Version :9

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:XP_005260286.1 Gene:TCEA2 / 6919 HGNCID:11614 Length:324 Species:Homo sapiens


Alignment Length:160 Identity:76/160 - (47%)
Similarity:116/160 - (72%) Gaps:3/160 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IRIKCREMLATALKSGNMPPGCG-DPDDMAAKLEDAIYGDLNGCKVKYKNRIRSRLANLRDPKNP 68
            :|.||||||..||::.:.....| |.:.::|::|:.|:.|:....:|||||:|||::||:|.|||
Human   138 VRNKCREMLTAALQTDHDHVAIGADCERLSAQIEECIFRDVGNTDMKYKNRVRSRISNLKDAKNP 202

  Fly    69 ELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQKYVQDSINAAQMAKVQGTKTDQFKCERCDKR 133
            :||:..|.|.|||::::.||.||||||::|::|:...:::|...|||:..||:||.|.|.:|.|:
Human   203 DLRRNVLCGAITPQQIAVMTSEEMASDELKEIRKAMTKEAIREHQMARTGGTQTDLFTCGKCRKK 267

  Fly   134 NC--SQLHIRDGDEPIITFVICDECGNRWK 161
            ||  :|:..|..|||:.|||:|:|||||||
Human   268 NCTYTQVQTRSSDEPMTTFVVCNECGNRWK 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 46/104 (44%)
Zn-ribbon 118..161 CDD:295390 24/44 (55%)
TCEA2XP_005260286.1 TFIIS_I 5..81 CDD:238107
TFSII 6..297 CDD:273592 74/158 (47%)
TFIIS_M 136..243 CDD:284835 46/104 (44%)
Zn-ribbon_TFIIS 252..297 CDD:259796 24/44 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5307
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001112
OrthoInspector 1 1.000 - - otm40693
orthoMCL 1 0.900 - - OOG6_101177
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2312
SonicParanoid 1 1.000 - - X770
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.700

Return to query results.
Submit another query.