DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and Polr3k

DIOPT Version :9

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_080177.1 Gene:Polr3k / 67005 MGIID:1914255 Length:108 Species:Mus musculus


Alignment Length:154 Identity:35/154 - (22%)
Similarity:47/154 - (30%) Gaps:68/154 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PGCGDPDDMAAKLEDAIYGDLNGCKVK--------------YKNRIRSRLANLRDPKNPELRQKF 74
            ||||                 ||..|:              |.:.|..::.|.:.||..|:    
Mouse     6 PGCG-----------------NGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEV---- 49

  Fly    75 LLGQITPEELSKMTPEEMASDDMKQMRQKYVQDSINAAQMAKVQGTKTDQFKCERCDKRNCSQLH 139
                                ||:..          .||....|..|.....|||. .:....||.
Mouse    50 --------------------DDVLG----------GAAAWENVDSTAEPCPKCEH-PRAYFMQLQ 83

  Fly   140 IRDGDEPIITFVIC--DECGNRWK 161
            .|..|||:.||..|  .:||:||:
Mouse    84 TRSADEPMTTFYKCCNAQCGHRWR 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 15/98 (15%)
Zn-ribbon 118..161 CDD:295390 16/44 (36%)
Polr3kNP_080177.1 RPB9 1..108 CDD:224510 35/154 (23%)
Zn-ribbon_RPC11 61..108 CDD:259794 18/48 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.