DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and Polr3k

DIOPT Version :10

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_080177.1 Gene:Polr3k / 67005 MGIID:1914255 Length:108 Species:Mus musculus


Alignment Length:154 Identity:35/154 - (22%)
Similarity:47/154 - (30%) Gaps:68/154 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PGCGDPDDMAAKLEDAIYGDLNGCKVK--------------YKNRIRSRLANLRDPKNPELRQKF 74
            ||||                 ||..|:              |.:.|..::.|.:.||..|:    
Mouse     6 PGCG-----------------NGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEV---- 49

  Fly    75 LLGQITPEELSKMTPEEMASDDMKQMRQKYVQDSINAAQMAKVQGTKTDQFKCERCDKRNCSQLH 139
                                ||:..          .||....|..|.....|||. .:....||.
Mouse    50 --------------------DDVLG----------GAAAWENVDSTAEPCPKCEH-PRAYFMQLQ 83

  Fly   140 IRDGDEPIITFVIC--DECGNRWK 161
            .|..|||:.||..|  .:||:||:
Mouse    84 TRSADEPMTTFYKCCNAQCGHRWR 107

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFSII <4..161 CDD:273592 34/152 (22%)
Polr3kNP_080177.1 RPB9 4..107 CDD:441202 34/152 (22%)
Zn-ribbon_RPC11 61..108 CDD:259794 18/48 (38%)