DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and dido1

DIOPT Version :9

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001073424.1 Gene:dido1 / 553277 ZFINID:ZDB-GENE-030131-6117 Length:530 Species:Danio rerio


Alignment Length:121 Identity:30/121 - (24%)
Similarity:42/121 - (34%) Gaps:30/121 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RIKCREMLATALKSGNMPPGCGDPDDMAAKLEDAIYGDLNGC---------------------KV 49
            :||..:.:..|  .|:..|.|..|......|.|::|.. |.|                     |.
Zfish   359 KIKIFQPVPAA--EGSSLPKCIGPGCERDALPDSVYCG-NDCILRHAAAAMKTITTDGKDSKQKE 420

  Fly    50 KYKNRIRSRLANLRDPK---NPELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQ 102
            |.|::.:.:..|....|   .||.|.....||   ||.|...|||...|:.|...:
Zfish   421 KSKSKAQKKTTNKSPQKKSSGPERRSSSNQGQ---EEESASLPEENEDDEDKHAEE 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 30/121 (25%)
Zn-ribbon 118..161 CDD:295390
dido1NP_001073424.1 PHD_DIDO1_like 237..290 CDD:277109
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.