DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and tcea3

DIOPT Version :9

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001016290.1 Gene:tcea3 / 549044 XenbaseID:XB-GENE-5904168 Length:292 Species:Xenopus tropicalis


Alignment Length:163 Identity:79/163 - (48%)
Similarity:115/163 - (70%) Gaps:3/163 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SMEIRIKCREMLATALKSGNMPPGCG-DPDDMAAKLEDAIYGDLNGCKVKYKNRIRSRLANLRDP 65
            |..:|.||||||..||::.......| |.:.:||::|:.::|::....:|||||||||::||:|.
 Frog   128 SDSVRTKCREMLRAALQTDGDHVAIGADCEFLAAQIEEVVFGEMQNTDMKYKNRIRSRISNLKDS 192

  Fly    66 KNPELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQKYVQDSINAAQMAKVQGTKTDQFKCERC 130
            |||:||:..|.|.|.||:::.|:.|||||:::|:||:...:.:|...||||..||:||.|.|.:|
 Frog   193 KNPDLRKNVLCGVIGPEQIAVMSCEEMASNELKEMRKAMTKAAIQEHQMAKTGGTQTDLFTCGKC 257

  Fly   131 DKRNC--SQLHIRDGDEPIITFVICDECGNRWK 161
            .|:||  :|:.||..|||:.|||.|:|||||||
 Frog   258 KKKNCTYTQVQIRSADEPMTTFVACNECGNRWK 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 46/106 (43%)
Zn-ribbon 118..161 CDD:295390 25/44 (57%)
tcea3NP_001016290.1 TFSII 5..292 CDD:273592 79/163 (48%)
TFIIS_I 5..81 CDD:238107
TFIIS_M 129..236 CDD:284835 46/106 (43%)
Zn-ribbon_TFIIS 245..291 CDD:259796 27/46 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5224
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001112
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X770
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.