DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and LOC498453

DIOPT Version :9

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:XP_006251782.1 Gene:LOC498453 / 498453 RGDID:1591965 Length:301 Species:Rattus norvegicus


Alignment Length:163 Identity:80/163 - (49%)
Similarity:118/163 - (72%) Gaps:3/163 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SMEIRIKCREMLATALKSGNMPPGCG-DPDDMAAKLEDAIYGDLNGCKVKYKNRIRSRLANLRDP 65
            |..:|:|||||||.||::|:.....| |.:::.:::|:|||.::....:|||||:|||::||:|.
  Rat   137 SDSVRLKCREMLAAALRTGDDYVAIGADEEELGSQIEEAIYQEIRNTDMKYKNRVRSRISNLKDA 201

  Fly    66 KNPELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQKYVQDSINAAQMAKVQGTKTDQFKCERC 130
            |||.||:..|.|.|.|:..::||.||||||::|:||:...:::|...||||..||:||.|.|.:|
  Rat   202 KNPNLRKNVLCGNIPPDLFARMTAEEMASDELKEMRKNLTKEAIREHQMAKTGGTQTDLFTCGKC 266

  Fly   131 DKRNC--SQLHIRDGDEPIITFVICDECGNRWK 161
            .|:||  :|:..|..|||:.|||:|:|||||||
  Rat   267 KKKNCTYTQVQTRSADEPMTTFVVCNECGNRWK 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 48/106 (45%)
Zn-ribbon 118..161 CDD:295390 24/44 (55%)
LOC498453XP_006251782.1 TFSII 4..301 CDD:273592 80/163 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5176
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1579101at2759
OrthoFinder 1 1.000 - - FOG0001112
OrthoInspector 1 1.000 - - otm44829
orthoMCL 1 0.900 - - OOG6_101177
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X770
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.