DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and tcea3

DIOPT Version :9

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:XP_005158394.1 Gene:tcea3 / 402983 ZFINID:ZDB-GENE-040426-1860 Length:783 Species:Danio rerio


Alignment Length:160 Identity:78/160 - (48%)
Similarity:107/160 - (66%) Gaps:3/160 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IRIKCREMLATALKSGNMPPGCG-DPDDMAAKLEDAIYGDLNGCKVKYKNRIRSRLANLRDPKNP 68
            ||.||.|||..||::.:.....| :.:.|.|::||.||.:.....:|||||:|||::||:|||||
Zfish   622 IRDKCIEMLTAALRTDDDYKDYGTNCEAMGAEIEDYIYQETKATDMKYKNRVRSRISNLKDPKNP 686

  Fly    69 ELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQKYVQDSINAAQMAKVQGTKTDQFKCERCDKR 133
            .||:..|.|.|....::.||.||||||::||:|....|::|...||||..||.||..:|.:|.|:
Zfish   687 NLRKNVLAGAIELSRIASMTAEEMASDELKQLRNVLTQEAI
REHQMAKTGGTTTDLLQCGKCKKK 751

  Fly   134 NC--SQLHIRDGDEPIITFVICDECGNRWK 161
            ||  :|:..|..|||:.|||:|:|||||||
Zfish   752 NCTYNQVQTRSADEPMTTFVLCNECGNRWK 781

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 48/104 (46%)
Zn-ribbon 118..161 CDD:295390 23/44 (52%)
tcea3XP_005158394.1 TFIIS_I 4..80 CDD:238107
TFSII 5..>156 CDD:273592
TFIIS_M 620..727 CDD:284835 48/104 (46%)
Zn-ribbon_TFIIS 736..782 CDD:259796 25/46 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5163
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1579101at2759
OrthoFinder 1 1.000 - - FOG0001112
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101177
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2312
SonicParanoid 1 1.000 - - X770
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.