DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and tcea1

DIOPT Version :9

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_988887.1 Gene:tcea1 / 394482 XenbaseID:XB-GENE-1001315 Length:304 Species:Xenopus tropicalis


Alignment Length:163 Identity:82/163 - (50%)
Similarity:117/163 - (71%) Gaps:3/163 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SMEIRIKCREMLATALKSGNMPPGCG-DPDDMAAKLEDAIYGDLNGCKVKYKNRIRSRLANLRDP 65
            |..:||||||:||||||:|:.....| |.|::.|::|:|::.:....:.|||||||||:|||:|.
 Frog   140 SDSVRIKCRELLATALKTGDDHIAIGADVDELGAQIEEAVFQEFKNTEAKYKNRIRSRIANLKDA 204

  Fly    66 KNPELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQKYVQDSINAAQMAKVQGTKTDQFKCERC 130
            |||.||:..|.|.|.|:..::|:.||||||::|:||:...:::|...|||:..||:||.|.|.:|
 Frog   205 KNPNLRRNVLCGNIAPDLFARMSAEEMASDELKEMRKNLTKEAIREHQMARTGGTETDLFTCGKC 269

  Fly   131 DKRNC--SQLHIRDGDEPIITFVICDECGNRWK 161
            .|:||  :|:..|..|||:.|||.|:|||||||
 Frog   270 KKKNCTYTQVQTRSADEPMTTFVFCNECGNRWK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 51/106 (48%)
Zn-ribbon 118..161 CDD:295390 24/44 (55%)
tcea1NP_988887.1 TFSII 6..304 CDD:273592 82/163 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5224
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1579101at2759
OrthoFinder 1 1.000 - - FOG0001112
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2312
SonicParanoid 1 1.000 - - X770
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.