DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and Tceanc

DIOPT Version :9

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001102485.1 Gene:Tceanc / 367782 RGDID:1584894 Length:358 Species:Rattus norvegicus


Alignment Length:182 Identity:66/182 - (36%)
Similarity:100/182 - (54%) Gaps:34/182 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MEIRIKCREMLATALKSGNMPPGCGDP------DDMAAKLEDAIY----GDLNGCKVKYKNRIRS 57
            :.:|.||.|:|..||.|     .|.|.      .::|.::|:.|:    .|:.    ||||.|||
  Rat   179 VSVRSKCIELLYKALAS-----SCTDHTKVHFWQNLARQIEEHIFTLHSNDIK----KYKNNIRS 234

  Fly    58 RLANLRDPKNPELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQKYVQDSINAAQMAK-VQGTK 121
            ::|||.:|:|..|:|..|.|.|:..|.::||..:||:.::||:|..|::.||....:.: |.||.
  Rat   235 KVANLNNPRNSHLQQNLLSGTISAREFAEMTVLDMANQELKQLRASYIESSIQEHHLPQIVDGTH 299

  Fly   122 TDQFKCERCDKRNCSQLHIRDG-------------DEPIITFVICDECGNRW 160
            |::.||.||||.||:...|..|             ||. :|:|||:|||.:|
  Rat   300 TNKIKCRRCDKYNCTVTVIARGTLFLPSWVQNSNPDEQ-MTYVICNECGEQW 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 40/115 (35%)
Zn-ribbon 118..161 CDD:295390 23/56 (41%)
TceancNP_001102485.1 TFSII 6..350 CDD:273592 65/180 (36%)
TFIIS_M 180..286 CDD:284835 40/114 (35%)
Zn-ribbon 297..350 CDD:295390 22/53 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1579101at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.