DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and Phf3

DIOPT Version :9

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001102261.1 Gene:Phf3 / 363210 RGDID:1304925 Length:2020 Species:Rattus norvegicus


Alignment Length:103 Identity:34/103 - (33%)
Similarity:59/103 - (57%) Gaps:8/103 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IRIKCREMLATALKSGNMPPGCGDPDD----MAAKLEDAIYGDLNGCKVKYKNRIRSRLANLRDP 65
            :|...:::|...|...|:.    .|::    :|.|:|..::........||||:.||.:.||:||
  Rat   914 VRHSLKDILMKRLTDSNLK----IPEEKSAKVATKIEKELFSFFRDTDAKYKNKYRSLMFNLKDP 974

  Fly    66 KNPELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQK 103
            ||..|.:|.|.|::||:.|.:|:|||:||.::...|::
  Rat   975 KNNILFKKVLKGEVTPDHLIRMSPEELASKELAAWRRR 1012

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 34/103 (33%)
Zn-ribbon 118..161 CDD:295390
Phf3NP_001102261.1 PHD_PHF3 698..748 CDD:277108
TFIIS_M 908..1018 CDD:284835 34/103 (33%)
SPOC 1193..1299 CDD:285043
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.