DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and Dido1

DIOPT Version :9

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:XP_006235867.1 Gene:Dido1 / 362286 RGDID:1311173 Length:2258 Species:Rattus norvegicus


Alignment Length:135 Identity:35/135 - (25%)
Similarity:58/135 - (42%) Gaps:21/135 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EIRIKCREMLATAL-KSGNMPPGCGDPDDM----------AAKLEDAIYGDLNGCKVKYKNRIRS 57
            :||...|..|...| |..|      |.||:          |..:|..::........:||::.||
  Rat   668 QIRQNIRRSLKEILWKRVN------DSDDLIMTENEVGKIALHIEKEMFNLFQVTDNRYKSKYRS 726

  Fly    58 RLANLRDPKNPELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQK----YVQDSINAAQMAKVQ 118
            .:.||:||||..|..:.|..:|:..:|.:|.|||:.|.::....:|    .::........:|..
  Rat   727 IMFNLKDPKNQGLFHRVLREEISLAKLVRMKPEELVSKELSMWTEKPTKSVIESRTKLLNESKKN 791

  Fly   119 GTKTD 123
            .||.:
  Rat   792 STKPE 796

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 32/119 (27%)
Zn-ribbon 118..161 CDD:295390 2/6 (33%)
Dido1XP_006235867.1 TNG2 <157..299 CDD:227367
PHD_DIDO1_like 263..316 CDD:277109
TFS2M 671..772 CDD:128786 29/106 (27%)
SPOC 1046..1194 CDD:400205
SWIRM-assoc_1 <1465..1502 CDD:406808
PHA03247 <1564..2085 CDD:223021
SF-CC1 2144..>2182 CDD:273721
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.