DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and tcea1

DIOPT Version :9

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_956288.1 Gene:tcea1 / 336105 ZFINID:ZDB-GENE-030131-8049 Length:309 Species:Danio rerio


Alignment Length:163 Identity:77/163 - (47%)
Similarity:115/163 - (70%) Gaps:3/163 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SMEIRIKCREMLATALKSGNMPPGCG-DPDDMAAKLEDAIYGDLNGCKVKYKNRIRSRLANLRDP 65
            |..:||||||||:.||::|:.....| |.|::.|::|:.|:.:.....:|||||:|||::||:|.
Zfish   145 SDSVRIKCREMLSNALQTGDDYITIGSDCDELGAQIEECIFLEFKNTDMKYKNRVRSRISNLKDA 209

  Fly    66 KNPELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQKYVQDSINAAQMAKVQGTKTDQFKCERC 130
            |||.||:..|.|.::|:.::|||.||||||::|:||:...:::|...|:|...||:||.|.|.:|
Zfish   210 KNPNLRRNVLCGNVSPDRIAKMTAEEMASDELKEMRKNLTKEAIRDHQVATSGGTQTDLFTCGKC 274

  Fly   131 DKRNC--SQLHIRDGDEPIITFVICDECGNRWK 161
            .|:.|  :|:..|..|||:.|||.|:|||||||
Zfish   275 KKKKCTYTQVQTRSADEPMTTFVFCNECGNRWK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 48/106 (45%)
Zn-ribbon 118..161 CDD:295390 23/44 (52%)
tcea1NP_956288.1 TFIIS_I 6..82 CDD:238107
TFSII 7..309 CDD:273592 77/163 (47%)
TFIIS_M 146..253 CDD:284835 48/106 (45%)
Zn-ribbon_TFIIS 262..308 CDD:259796 25/46 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5163
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1579101at2759
OrthoFinder 1 1.000 - - FOG0001112
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101177
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2312
SonicParanoid 1 1.000 - - X770
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.