DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and Tcea2

DIOPT Version :9

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:XP_006235802.1 Gene:Tcea2 / 29575 RGDID:61825 Length:318 Species:Rattus norvegicus


Alignment Length:160 Identity:73/160 - (45%)
Similarity:114/160 - (71%) Gaps:3/160 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IRIKCREMLATALKSGNMPPGCG-DPDDMAAKLEDAIYGDLNGCKVKYKNRIRSRLANLRDPKNP 68
            :|.||||||..||::.:.....| ..:.:::::|:.|:.|:....:|||||:|||::||:|.|||
  Rat   157 VRNKCREMLTLALQTDHDHVAVGVSCEHLSSQIEECIFLDVGNTDMKYKNRVRSRISNLKDAKNP 221

  Fly    69 ELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQKYVQDSINAAQMAKVQGTKTDQFKCERCDKR 133
            .||:..|.|.|||::::.||.||||||::|::|:...:::|...|||:..||:||.|.|.:|.|:
  Rat   222 GLRRNVLCGAITPQQIAVMTSEEMASDELKEIRKAMTKEAIREHQMARTGGTQTDLFTCNKCRKK 286

  Fly   134 NC--SQLHIRDGDEPIITFVICDECGNRWK 161
            ||  :|:..|..|||:.|:|:|:|||||||
  Rat   287 NCTYTQVQTRSSDEPMTTYVVCNECGNRWK 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 44/104 (42%)
Zn-ribbon 118..161 CDD:295390 23/44 (52%)
Tcea2XP_006235802.1 TFSII 35..318 CDD:273592 73/160 (46%)
TFIIS_I <35..94 CDD:238107
TFIIS_M 155..262 CDD:284835 44/104 (42%)
Zn-ribbon_TFIIS 271..317 CDD:259796 25/46 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5176
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1579101at2759
OrthoFinder 1 1.000 - - FOG0001112
OrthoInspector 1 1.000 - - otm44829
orthoMCL 1 0.900 - - OOG6_101177
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X770
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.720

Return to query results.
Submit another query.