DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and AT2G42725

DIOPT Version :9

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001324130.1 Gene:AT2G42725 / 28718350 AraportID:AT2G42725 Length:247 Species:Arabidopsis thaliana


Alignment Length:116 Identity:42/116 - (36%)
Similarity:57/116 - (49%) Gaps:25/116 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RIKCREMLATAL----------KSGNMPPGCGDPDDMAAKLEDAIYGDLNGC-----KVKYKNRI 55
            |.|.||:|.|:|          :.......| ||..:|..:|.|::..| ||     |.||    
plant   117 RDKVREILQTSLVKVASEIVDTEMKTRVTAC-DPSVVAVSVESAMFEKL-GCFMGPHKAKY---- 175

  Fly    56 RSRLANLRDPKNPELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQKYVQ 106
            ||.|.|:.|..||:||:|.|:|:|..|.|..|..:||.|:.:    ||.||
plant   176 RSILFNMGDSNNPDLRRKVLIGEINGERLVTMERQEMGSEKI----QKEVQ 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 42/116 (36%)
Zn-ribbon 118..161 CDD:295390
AT2G42725NP_001324130.1 TFSII 14..233 CDD:273592 42/116 (36%)
TFS2M 118..223 CDD:128786 41/115 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1579101at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1141
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.