DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and tfs1

DIOPT Version :9

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_593623.1 Gene:tfs1 / 2541941 PomBaseID:SPAC20H4.03c Length:293 Species:Schizosaccharomyces pombe


Alignment Length:114 Identity:51/114 - (44%)
Similarity:70/114 - (61%) Gaps:2/114 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 KYKNRIRSRLANLRDPKNPELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQKYVQDSINAAQM 114
            :|:||:||...||:|..||:||...|..:|||:.||.||..|:||:|.::...|..|:::..||.
pombe   178 EYRNRMRSLYMNLKDKNNPKLRASVLRNEITPQRLSTMTSAELASEDRRKEDAKLEQENLFHAQG 242

  Fly   115 AKVQGTKTDQFKCERCDKRNCS--QLHIRDGDEPIITFVICDECGNRWK 161
            ||.|...||.|.|.:|.::..|  |:..|..|||:.||..|..||||||
pombe   243 AKPQKAVTDLFTCGKCKQKKVSYYQMQTRSADEPMTTFCECTVCGNRWK 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 26/58 (45%)
Zn-ribbon 118..161 CDD:295390 19/44 (43%)
tfs1NP_593623.1 TFSII 3..293 CDD:273592 51/114 (45%)
TFIIS_I 3..78 CDD:238107
TFIIS_M 131..237 CDD:284835 26/58 (45%)
Zn-ribbon_TFIIS 246..292 CDD:259796 21/46 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 56 1.000 Domainoid score I3148
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 140 1.000 Inparanoid score I1373
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001112
OrthoInspector 1 1.000 - - otm47089
orthoMCL 1 0.900 - - OOG6_101177
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2312
SonicParanoid 1 1.000 - - X770
TreeFam 1 0.960 - -
1110.750

Return to query results.
Submit another query.