DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and SPCC645.13

DIOPT Version :9

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001342882.1 Gene:SPCC645.13 / 2538700 PomBaseID:SPCC645.13 Length:721 Species:Schizosaccharomyces pombe


Alignment Length:100 Identity:27/100 - (27%)
Similarity:52/100 - (52%) Gaps:9/100 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 KYKNRIRSRLANLRDPKNPELRQKFLLGQITPEELSKMTPEEMASDDMK----QMRQKYVQDSIN 110
            ||:.:.|:...||.|.|||..|.:.|..:|:..:|..::.||||:.|:|    ::||:..::::.
pombe   277 KYREKFRALRFNLVDDKNPAFRARVLKNEISFNDLVNLSSEEMANPDLKNLAEEIRQQSTENTVI 341

  Fly   111 AAQMAKVQGTKTDQFKCERCDKRNCSQLHIRDGDE 145
            ...:...:....|:.|..:.|     :|.|.:.|:
pombe   342 KQHLIAPRDRLLDEDKLTQQD-----ELGIAENDD 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 21/62 (34%)
Zn-ribbon 118..161 CDD:295390 6/27 (22%)
SPCC645.13NP_001342882.1 PHD_SF 22..66 CDD:328929
TFS2M 215..330 CDD:128786 19/52 (37%)
SPOC 474..624 CDD:311609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.