DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and PHF3

DIOPT Version :9

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:XP_011533950.1 Gene:PHF3 / 23469 HGNCID:8921 Length:2048 Species:Homo sapiens


Alignment Length:103 Identity:35/103 - (33%)
Similarity:59/103 - (57%) Gaps:8/103 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IRIKCREMLATALKSGNMPPGCGDPDDMAA----KLEDAIYGDLNGCKVKYKNRIRSRLANLRDP 65
            :|...:::|...|...|:..    |::.||    |:|..::........||||:.||.:.||:||
Human   940 VRHSLKDILMKRLTDSNLKV----PEEKAAKVATKIEKELFSFFRDTDAKYKNKYRSLMFNLKDP 1000

  Fly    66 KNPELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQK 103
            ||..|.:|.|.|::||:.|.:|:|||:||.::...|::
Human  1001 KNNILFKKVLKGEVTPDHLIRMSPEELASKELAAWRRR 1038

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 35/103 (34%)
Zn-ribbon 118..161 CDD:295390
PHF3XP_011533950.1 PHD_PHF3 728..778 CDD:277108
TFIIS_M 934..1044 CDD:284835 35/103 (34%)
SPOC 1218..1324 CDD:285043
PRP38_assoc <1941..2035 CDD:289628
DUF1777 1954..>2048 CDD:285811
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6592
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.