DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and Tcea3

DIOPT Version :9

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:XP_006538773.1 Gene:Tcea3 / 21401 MGIID:1196908 Length:385 Species:Mus musculus


Alignment Length:160 Identity:78/160 - (48%)
Similarity:114/160 - (71%) Gaps:3/160 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IRIKCREMLATALKSGNMPPGCG-DPDDMAAKLEDAIYGDLNGCKVKYKNRIRSRLANLRDPKNP 68
            :|.||.|||:.|||:.:.....| :.|.:|:::||.||.:|....:||:||:|||::||:||:||
Mouse   224 VRDKCVEMLSAALKAEDNFKDYGVNCDKLASEIEDHIYQELKSTDMKYRNRVRSRISNLKDPRNP 288

  Fly    69 ELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQKYVQDSINAAQMAKVQGTKTDQFKCERCDKR 133
            .||:..|.|.|:||.::|||.||||||:::::|....|::|...||||..||.||..:|.:|.|:
Mouse   289 GLRRNVLSGAISPELIAKMTAEEMASDELRELRNAMTQEAIREHQMAKTGGTTTDLLRCSKCKKK 353

  Fly   134 NC--SQLHIRDGDEPIITFVICDECGNRWK 161
            ||  :|:..|..|||:.|||:|:|||||||
Mouse   354 NCTYNQVQTRSADEPMTTFVLCNECGNRWK 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 48/104 (46%)
Zn-ribbon 118..161 CDD:295390 23/44 (52%)
Tcea3XP_006538773.1 TFSII 5..385 CDD:273592 78/160 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5287
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1579101at2759
OrthoFinder 1 1.000 - - FOG0001112
OrthoInspector 1 1.000 - - otm42767
orthoMCL 1 0.900 - - OOG6_101177
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2312
SonicParanoid 1 1.000 - - X770
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.710

Return to query results.
Submit another query.