DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and Tcea1

DIOPT Version :9

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001153223.1 Gene:Tcea1 / 21399 MGIID:1196624 Length:312 Species:Mus musculus


Alignment Length:163 Identity:80/163 - (49%)
Similarity:118/163 - (72%) Gaps:3/163 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SMEIRIKCREMLATALKSGNMPPGCG-DPDDMAAKLEDAIYGDLNGCKVKYKNRIRSRLANLRDP 65
            |..:|:|||||||.||::|:.....| |.:::.:::|:|||.::....:|||||:|||::||:|.
Mouse   148 SDSVRLKCREMLAAALRTGDDYVAIGADEEELGSQIEEAIYQEIRNTDMKYKNRVRSRISNLKDA 212

  Fly    66 KNPELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQKYVQDSINAAQMAKVQGTKTDQFKCERC 130
            |||.||:..|.|.|.|:..::||.||||||::|:||:...:::|...||||..||:||.|.|.:|
Mouse   213 KNPNLRKNVLCGNIPPDLFARMTAEEMASDELKEMRKNLTKEAIREHQMAKTGGTQTDLFTCGKC 277

  Fly   131 DKRNC--SQLHIRDGDEPIITFVICDECGNRWK 161
            .|:||  :|:..|..|||:.|||:|:|||||||
Mouse   278 KKKNCTYTQVQTRSADEPMTTFVVCNECGNRWK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 48/106 (45%)
Zn-ribbon 118..161 CDD:295390 24/44 (55%)
Tcea1NP_001153223.1 TFSII 33..312 CDD:273592 80/163 (49%)
TFIIS_I <35..89 CDD:238107
TFIIS_M 149..256 CDD:284835 48/106 (45%)
Zn-ribbon_TFIIS 265..311 CDD:259796 26/46 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5287
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001112
OrthoInspector 1 1.000 - - otm42767
orthoMCL 1 0.900 - - OOG6_101177
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2312
SonicParanoid 1 1.000 - - X770
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.700

Return to query results.
Submit another query.