DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and TCEANC

DIOPT Version :9

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_689847.2 Gene:TCEANC / 170082 HGNCID:28277 Length:381 Species:Homo sapiens


Alignment Length:171 Identity:61/171 - (35%)
Similarity:96/171 - (56%) Gaps:15/171 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IRIKCREMLATALKSGNMPPGCGDP-DDMAAKLEDAIYGDLNGCKVKYKNRIRSRLANLRDPKNP 68
            :|.||.|:|..||.|.:......|. .:.|.::|:.::...:....|||..|||::|||::|:|.
Human   203 MRTKCIELLYAALTSSSTDQPKADLWQNFAREIEEHVFTLYSKNIKKYKTCIRSKVANLKNPRNS 267

  Fly    69 ELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQKYVQDSINAAQMAKV-QGTKTDQFKCERCDK 132
            .|:|..|.|..:|.|.::||..|||:.::||:|..|.:..|....:.:| .||:|::.||.||:|
Human   268 HLQQNLLSGTTSPREFAEMTVMEMANKELKQLRASYTESCIQEHYLPQVIDGTQTNKIKCRRCEK 332

  Fly   133 RNCSQLHIRDG-------------DEPIITFVICDECGNRW 160
            .||....|..|             ||.::|:|||:|||.:|
Human   333 YNCKVTVIDRGTLFLPSWVRNSNPDEQMMTYVICNECGEQW 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 37/104 (36%)
Zn-ribbon 118..161 CDD:295390 22/56 (39%)
TCEANCNP_689847.2 TFSII 36..373 CDD:273592 60/169 (36%)
Med26 59..108 CDD:285873
TFIIS_M 202..308 CDD:284835 37/104 (36%)
Zn-ribbon 319..373 CDD:295390 21/53 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1579101at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.