DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and tceanc

DIOPT Version :9

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001120586.1 Gene:tceanc / 100145741 XenbaseID:XB-GENE-942644 Length:349 Species:Xenopus tropicalis


Alignment Length:173 Identity:58/173 - (33%)
Similarity:97/173 - (56%) Gaps:18/173 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MEIRIKCREMLATALKSGNMPPGCGDP-DDMAAKLEDAIYGDLNGCKVKYKNRIRSRLANLRDPK 66
            :.:|.||.|:|..||:..:   .|.:. .::|..:|:.||....|...||:|.|||:::||::||
 Frog   172 LALRTKCTELLYQALREDS---ECQEKLQNLAKAIEENIYKIHAGNTKKYRNCIRSKISNLKNPK 233

  Fly    67 NPELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQKYVQDSINAAQMAK-VQGTKTDQFKCERC 130
            |..|:.:.|...::|:..::|...|||.|:::.:|..|.:..:...|:.: |.|..|::.:|.||
 Frog   234 NSHLKMQILSRALSPKVFAEMGVMEMACDELRNLRANYTETCVQEHQLPQGVDGVHTNKIRCRRC 298

  Fly   131 DKRNCSQLHIRDG-------------DEPIITFVICDECGNRW 160
            ||.||:...|..|             ||.::|||||:|||.:|
 Frog   299 DKFNCTVTMISRGTLFLPGWVRTGNPDEEMMTFVICNECGEQW 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 34/106 (32%)
Zn-ribbon 118..161 CDD:295390 22/56 (39%)
tceancNP_001120586.1 TFSII 33..341 CDD:273592 57/171 (33%)
TFIIS_M 173..279 CDD:400056 34/108 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1579101at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.