DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sog and CHRDL2

DIOPT Version :9

Sequence 1:NP_001259576.1 Gene:sog / 32498 FlyBaseID:FBgn0003463 Length:1038 Species:Drosophila melanogaster
Sequence 2:NP_056239.3 Gene:CHRDL2 / 25884 HGNCID:24168 Length:451 Species:Homo sapiens


Alignment Length:321 Identity:80/321 - (24%)
Similarity:111/321 - (34%) Gaps:61/321 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   744 CFHSGRFYNESEQWRSAQDS-----CQMCACLRG-QSSCEVIKCPALKCKSTEQLLQRDGECCPS 802
            |...|:.|:..|.|....:.     |..|.|..| ..||..:.||.:.|   .|.:....:|||.
Human    33 CLFHGKRYSPGESWHPYLEPQGLMYCLRCTCSEGAHVSCYRLHCPPVHC---PQPVTEPQQCCPK 94

  Fly   803 CVPKKEAADYSAQSSPATNATDLLQQRRGCRLGEQFHPAGASWHPFLPPNGFDTCTTCSCDPLTL 867
            ||.....:...|......:...:.|.      ||.|     |.|...|....:.|..|||  ...
Human    95 CVEPHTPSGLRAPPKSCQHNGTMYQH------GEIF-----SAHELFPSRLPNQCVLCSC--TEG 146

  Fly   868 EIRCPRLVCPPLQCSEKLAYRPDKKACCKIC----------------------PEGKQSSSNGHK 910
            :|.|....||...|...|.. ||  :||:.|                      |:...||..|.|
Human   147 QIYCGLTTCPEPGCPAPLPL-PD--SCCQACKDEASEQSDEEDSVQSLHGVRHPQDPCSSDAGRK 208

  Fly   911 TTPNNPNVLQDQA-MQRSPSHSAEEVLANGGCKVV------------NKVYENGQEWHPILMSHG 962
            ..|..|......| :...|.|...:...:...|:|            .|.|.:|:.|||...:.|
Human   209 RGPGTPAPTGLSAPLSFIPRHFRPKGAGSTTVKIVLKEKHKKACVHGGKTYSHGEVWHPAFRAFG 273

  Fly   963 EQKCIKCRCKDSKVNCDRKRC-SRSTCQQQTRVTSKRRLFEKPDAAAPAIDECCSTQCRRS 1022
            ...||.|.|:|.:.:|.|..| :...|:...:|..|.......|.|.|...|..||:|.::
Human   274 PLPCILCTCEDGRQDCQRVTCPTEYPCRHPEKVAGKCCKICPEDKADPGHSEISSTRCPKA 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sogNP_001259576.1 VWC 102..174 CDD:278520
CHRD 200..334 CDD:214804
CHRD 341..467 CDD:214804
CHRD 473..585 CDD:214804
CHRD 594..708 CDD:214804
VWC 744..803 CDD:278520 18/64 (28%)
VWC 832..898 CDD:278520 20/65 (31%)
VWC 941..1017 CDD:278520 24/88 (27%)
CHRDL2NP_056239.3 VWC 33..95 CDD:214564 18/64 (28%)
VWC 111..174 CDD:302663 21/78 (27%)
VWC 252..314 CDD:214564 18/61 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I12115
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.